Lineage for d5ll1e2 (5ll1 E:143-294)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2967038Species Zebrafish (Danio rerio) [TaxId:7955] [327451] (2 PDB entries)
  8. 2967048Domain d5ll1e2: 5ll1 E:143-294 [329164]
    automated match to d4n9sa2

Details for d5ll1e2

PDB Entry: 5ll1 (more details), 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish
PDB Compounds: (E:) Uricase

SCOPe Domain Sequences for d5ll1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ll1e2 d.96.1.0 (E:143-294) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
sktpvvhsglkdmkvlkttqtgfegflrdrfttltdakdrffctsvyarwryntinvafd
aawkavkdtviqkfagpydrgeyspsvqktlydtqllvldripeveeieiimpnqhyfvi
dmtkiglsnkdevylpldnpsgnitgtvcrkp

SCOPe Domain Coordinates for d5ll1e2:

Click to download the PDB-style file with coordinates for d5ll1e2.
(The format of our PDB-style files is described here.)

Timeline for d5ll1e2: