Lineage for d4gtub2 (4gtu B:1-84)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245016Protein Class mu GST [81359] (3 species)
  7. 245024Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 245043Domain d4gtub2: 4gtu B:1-84 [32916]
    Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtub2

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtub2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens)}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d4gtub2:

Click to download the PDB-style file with coordinates for d4gtub2.
(The format of our PDB-style files is described here.)

Timeline for d4gtub2:

245043
d4gtub2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4gtub1