Lineage for d5ws0b1 (5ws0 B:662-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325501Domain d5ws0b1: 5ws0 B:662-796 [329156]
    Other proteins in same PDB: d5ws0a2, d5ws0a3, d5ws0b2, d5ws0b3
    automated match to d4hhyd1
    complexed with 7u6

Details for d5ws0b1

PDB Entry: 5ws0 (more details), 2.6 Å

PDB Description: structure of human parp1 catalytic domain bound to a benzoimidazole inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5ws0b1:

Sequence, based on SEQRES records: (download)

>d5ws0b1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d5ws0b1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgsdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek

SCOPe Domain Coordinates for d5ws0b1:

Click to download the PDB-style file with coordinates for d5ws0b1.
(The format of our PDB-style files is described here.)

Timeline for d5ws0b1: