Lineage for d5ugyf_ (5ugy F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041164Domain d5ugyf_: 5ugy F: [329153]
    Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyc1, d5ugyc2, d5ugye1, d5ugye2, d5ugyh_, d5ugyi_, d5ugyj_, d5ugyl1, d5ugyl2, d5ugym1, d5ugym2, d5ugyn1, d5ugyn2
    automated match to d3sm5b_
    complexed with nag

Details for d5ugyf_

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5ugyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugyf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki

SCOPe Domain Coordinates for d5ugyf_:

Click to download the PDB-style file with coordinates for d5ugyf_.
(The format of our PDB-style files is described here.)

Timeline for d5ugyf_: