SCOPe 2.08: Domain d5ugyl1: 5ugy L:2-108

Lineage for d5ugyl1 (5ugy L:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ugyl1: 5ugy L:2-108 [329151]
   Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyb_, d5ugyc1, d5ugyc2, d5ugyd_, d5ugye1, d5ugye2, d5ugyf_
   automated match to d3sm5l1
   complexed with nag

Details for d5ugyl1

PDB Entry: 5ugy, 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody

PDB Compounds: (L:) CH65 light chain

SCOPe Domain Sequences for d5ugyl1:

Sequence; same for both SEQRES and ATOM records:

>d5ugyl1 b.1.1.0 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvl

Timeline for d5ugyl1:

• d5ugyl1 first appeared in SCOPe 2.06
  
• d5ugyl1 appears in SCOPe 2.07