SCOP 1.55: Domain d4gtua2: 4gtu A:1-84

Lineage for d4gtua2 (4gtu A:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)

8. Domain d4gtua2: 4gtu A:1-84 [32915]
   Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1

Details for d4gtua2

PDB Entry: 4gtu, 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtua2:

Sequence; same for both SEQRES and ATOM records:

>d4gtua2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

Timeline for d4gtua2:

• d4gtua2 appears in SCOP 1.57
  
• d4gtua2 appears in the current release, SCOPe 2.08