Lineage for d5uf8c_ (5uf8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868013Species Candida albicans [TaxId:237561] [329047] (2 PDB entries)
  8. 2868016Domain d5uf8c_: 5uf8 C: [329147]
    automated match to d2k5ua_
    complexed with gdp

Details for d5uf8c_

PDB Entry: 5uf8 (more details), 1.87 Å

PDB Description: crystal structure of the arf family small gtpase arf2 from candida albicans in complex with gdp
PDB Compounds: (C:) Potential ADP-ribosylation factor

SCOPe Domain Sequences for d5uf8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uf8c_ c.37.1.8 (C:) automated matches {Candida albicans [TaxId: 237561]}
emrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirp
lwryyfqntqgiifvvdsndrdriaeareelqqmlnedelrdalllvfankqdlpnamna
aeiteklglhsirqrpwyiqatcattgdglyeglewlstnl

SCOPe Domain Coordinates for d5uf8c_:

Click to download the PDB-style file with coordinates for d5uf8c_.
(The format of our PDB-style files is described here.)

Timeline for d5uf8c_: