Lineage for d1hnbb2 (1hnb B:1-84)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 833885Protein Class mu GST [81359] (3 species)
  7. 833893Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488
    Uniprot P28161
    Uniprot P09488 ! Uniprot P28161
  8. 833938Domain d1hnbb2: 1hnb B:1-84 [32914]
    Other proteins in same PDB: d1hnba1, d1hnbb1
    complexed with gdn; mutant

Details for d1hnbb2

PDB Entry: 1hnb (more details), 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1hnbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnbb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hnbb2:

Click to download the PDB-style file with coordinates for d1hnbb2.
(The format of our PDB-style files is described here.)

Timeline for d1hnbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnbb1