Lineage for d5j59b2 (5j59 B:607-767)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316215Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2316216Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2316269Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2316270Protein automated matches [226872] (13 species)
    not a true protein
  7. 2316308Species Trypanosoma brucei [TaxId:999953] [226468] (27 PDB entries)
  8. 2316328Domain d5j59b2: 5j59 B:607-767 [329136]
    Other proteins in same PDB: d5j59a1, d5j59b1, d5j59b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with gol, met, n93

Details for d5j59b2

PDB Entry: 5j59 (more details), 2.4 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1893)
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j59b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j59b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d5j59b2:

Click to download the PDB-style file with coordinates for d5j59b2.
(The format of our PDB-style files is described here.)

Timeline for d5j59b2: