SCOPe 2.08: Domain d5j59b2: 5j59 B:607-767

Lineage for d5j59b2 (5j59 B:607-767)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries)

8. Domain d5j59b2: 5j59 B:607-767 [329136]
   Other proteins in same PDB: d5j59a1, d5j59b1, d5j59b3
   automated match to d4eg8b2
   protein/RNA complex; complexed with gol, met, n93

Details for d5j59b2

PDB Entry: 5j59, 2.4 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1893)

PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j59b2:

Sequence; same for both SEQRES and ATOM records:

>d5j59b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d5j59b2:

• d5j59b2 first appeared in SCOPe 2.06
  
• d5j59b2 appears in SCOPe 2.07