Lineage for d1hnba2 (1hnb A:1-84)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396119Protein Class mu GST [81359] (3 species)
  7. 396127Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 396143Domain d1hnba2: 1hnb A:1-84 [32913]
    Other proteins in same PDB: d1hnba1, d1hnbb1

Details for d1hnba2

PDB Entry: 1hnb (more details), 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnba2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens)}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hnba2:

Click to download the PDB-style file with coordinates for d1hnba2.
(The format of our PDB-style files is described here.)

Timeline for d1hnba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnba1