SCOPe 2.08: Domain d5ufpa_: 5ufp A:

Lineage for d5ufpa_ (5ufp A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)

8. Domain d5ufpa_: 5ufp A: [329119]
   Other proteins in same PDB: d5ufpb_
   automated match to d2a24a_
   complexed with 86d

Details for d5ufpa_

PDB Entry: 5ufp, 1.9 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex

PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d5ufpa_:

Sequence, based on SEQRES records:

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlse

Sequence, based on observed residues (ATOM records):

>d5ufpa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse

Timeline for d5ufpa_:

• d5ufpa_ first appeared in SCOPe 2.06
  
• d5ufpa_ appears in SCOPe 2.07