Lineage for d5ugye1 (5ugy E:5-326)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775761Domain d5ugye1: 5ugy E:5-326 [329114]
    Other proteins in same PDB: d5ugya2, d5ugyb_, d5ugyc2, d5ugyd_, d5ugye2, d5ugyf_, d5ugyh_, d5ugyi_, d5ugyj_, d5ugyl1, d5ugyl2, d5ugym1, d5ugym2, d5ugyn1, d5ugyn2
    automated match to d4edba_
    complexed with nag

Details for d5ugye1

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5ugye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugye1 b.19.1.2 (E:5-326) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d5ugye1:

Click to download the PDB-style file with coordinates for d5ugye1.
(The format of our PDB-style files is described here.)

Timeline for d5ugye1: