Lineage for d1hncc2 (1hnc C:1-84)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) 
Protein Class mu GST [81359] (3 species) Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries)
Uniprot P09488 ! Uniprot P28161
Domain d1hncc2: 1hnc C:1-84 [32911]
Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1
complexed with gdn
Details for d1hncc2
PDB Entry: 1hnc (more details), 3 Å
PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (C:) glutathione s-transferaseSCOPe Domain Sequences for d1hncc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hncc2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn
SCOPe Domain Coordinates for d1hncc2:
Click to download the PDB-style file with coordinates for d1hncc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hncc2:
View in 3D
