Lineage for d5ugyb_ (5ugy B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267291Domain d5ugyb_: 5ugy B: [329106]
    Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyc1, d5ugyc2, d5ugye1, d5ugye2, d5ugyl1, d5ugyl2, d5ugym1, d5ugym2, d5ugyn1, d5ugyn2
    automated match to d3sm5b_
    complexed with bma, nag

Details for d5ugyb_

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5ugyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugyb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki

SCOPe Domain Coordinates for d5ugyb_:

Click to download the PDB-style file with coordinates for d5ugyb_.
(The format of our PDB-style files is described here.)

Timeline for d5ugyb_: