Lineage for d5ws0a2 (5ws0 A:797-1011)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234260Domain d5ws0a2: 5ws0 A:797-1011 [329098]
    Other proteins in same PDB: d5ws0a1, d5ws0a3, d5ws0b1, d5ws0b3
    automated match to d4hhyd2
    complexed with 7u6

Details for d5ws0a2

PDB Entry: 5ws0 (more details), 2.6 Å

PDB Description: structure of human parp1 catalytic domain bound to a benzoimidazole inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5ws0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws0a2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5ws0a2:

Click to download the PDB-style file with coordinates for d5ws0a2.
(The format of our PDB-style files is described here.)

Timeline for d5ws0a2: