SCOPe 2.06: Domain d5ug4b_: 5ug4 B:

Lineage for d5ug4b_ (5ug4 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)

8. Domain d5ug4b_: 5ug4 B: [329083]
   automated match to d4jlya_
   complexed with act, ca, eoh, moh, mrd

Details for d5ug4b_

PDB Entry: 5ug4, 2.15 Å

PDB Description: structure of spermidine n-acetyltransferase speg from vibrio cholerae

PDB Compounds: (B:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d5ug4b_:

Sequence; same for both SEQRES and ATOM records:

>d5ug4b_ d.108.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

Timeline for d5ug4b_:

• d5ug4b_ is new in SCOPe 2.06-stable
  
• d5ug4b_ appears in SCOPe 2.07
  
• d5ug4b_ appears in the current release, SCOPe 2.08