Lineage for d3gtud2 (3gtu D:1-84)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 70977Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 70988Domain d3gtud2: 3gtu D:1-84 [32908]
    Other proteins in same PDB: d3gtua1, d3gtub1, d3gtuc1, d3gtud1

Details for d3gtud2

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtud2 c.47.1.5 (D:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
pnlpylldgknkitqsnailryia

SCOP Domain Coordinates for d3gtud2:

Click to download the PDB-style file with coordinates for d3gtud2.
(The format of our PDB-style files is described here.)

Timeline for d3gtud2: