![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.6: Orange carotenoid protein, C-terminal domain [82598] (1 protein) automatically mapped to Pfam PF02136 |
![]() | Protein Orange carotenoid protein, C-terminal domain [82599] (1 species) |
![]() | Species Arthrospira maxima [TaxId:129910] [82600] (2 PDB entries) |
![]() | Domain d5ui2b2: 5ui2 B:176-315 [329079] Other proteins in same PDB: d5ui2a1, d5ui2b1 automated match to d1m98a2 complexed with cl, eq3, suc |
PDB Entry: 5ui2 (more details), 2.1 Å
SCOPe Domain Sequences for d5ui2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ui2b2 d.17.4.6 (B:176-315) Orange carotenoid protein, C-terminal domain {Arthrospira maxima [TaxId: 129910]} epvvppqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivg kentlrffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrflln penkvffvaidllaspkell
Timeline for d5ui2b2: