Lineage for d5ui2b2 (5ui2 B:176-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936779Family d.17.4.6: Orange carotenoid protein, C-terminal domain [82598] (1 protein)
    automatically mapped to Pfam PF02136
  6. 2936780Protein Orange carotenoid protein, C-terminal domain [82599] (1 species)
  7. 2936781Species Arthrospira maxima [TaxId:129910] [82600] (1 PDB entry)
  8. 2936783Domain d5ui2b2: 5ui2 B:176-315 [329079]
    Other proteins in same PDB: d5ui2a1, d5ui2b1
    automated match to d1m98a2
    complexed with cl, eq3

Details for d5ui2b2

PDB Entry: 5ui2 (more details), 2.1 Å

PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5ui2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui2b2 d.17.4.6 (B:176-315) Orange carotenoid protein, C-terminal domain {Arthrospira maxima [TaxId: 129910]}
epvvppqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivg
kentlrffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrflln
penkvffvaidllaspkell

SCOPe Domain Coordinates for d5ui2b2:

Click to download the PDB-style file with coordinates for d5ui2b2.
(The format of our PDB-style files is described here.)

Timeline for d5ui2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ui2b1