SCOPe 2.08: Domain d5ui2b2: 5ui2 B:176-315

Lineage for d5ui2b2 (5ui2 B:176-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.6: Orange carotenoid protein, C-terminal domain [82598] (1 protein)
   automatically mapped to Pfam PF02136

6. Protein Orange carotenoid protein, C-terminal domain [82599] (1 species)

7. Species Arthrospira maxima [TaxId:129910] [82600] (1 PDB entry)

8. Domain d5ui2b2: 5ui2 B:176-315 [329079]
   Other proteins in same PDB: d5ui2a1, d5ui2b1
   automated match to d1m98a2
   complexed with cl, eq3

Details for d5ui2b2

PDB Entry: 5ui2, 2.1 Å

PDB Description: crystal structure of orange carotenoid protein

PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5ui2b2:

Sequence; same for both SEQRES and ATOM records:

>d5ui2b2 d.17.4.6 (B:176-315) Orange carotenoid protein, C-terminal domain {Arthrospira maxima [TaxId: 129910]}
epvvppqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivg
kentlrffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrflln
penkvffvaidllaspkell

Timeline for d5ui2b2:

• d5ui2b2 first appeared in SCOPe 2.06
  
• d5ui2b2 appears in SCOPe 2.07