Lineage for d3gtub2 (3gtu B:1-84)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123373Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)
  8. 123382Domain d3gtub2: 3gtu B:1-84 [32906]
    Other proteins in same PDB: d3gtua1, d3gtub1, d3gtuc1, d3gtud1

Details for d3gtub2

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtub2 c.47.1.5 (B:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
pnlpylldgknkitqsnailryia

SCOP Domain Coordinates for d3gtub2:

Click to download the PDB-style file with coordinates for d3gtub2.
(The format of our PDB-style files is described here.)

Timeline for d3gtub2: