Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) |
Domain d3gtua2: 3gtu A:1-84 [32905] Other proteins in same PDB: d3gtua1, d3gtub1, d3gtuc1, d3gtud1 |
PDB Entry: 3gtu (more details), 2.8 Å
SCOP Domain Sequences for d3gtua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gtua2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d3gtua2: