Lineage for d1gtud2 (1gtu D:1-84)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396119Protein Class mu GST [81359] (3 species)
  7. 396127Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries)
  8. 396134Domain d1gtud2: 1gtu D:1-84 [32904]
    Other proteins in same PDB: d1gtua1, d1gtub1, d1gtuc1, d1gtud1

Details for d1gtud2

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

SCOP Domain Sequences for d1gtud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtud2 c.47.1.5 (D:1-84) Class mu GST {Human (Homo sapiens)}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d1gtud2:

Click to download the PDB-style file with coordinates for d1gtud2.
(The format of our PDB-style files is described here.)

Timeline for d1gtud2: