Lineage for d1gtuc2 (1gtu C:1-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484752Protein Class mu GST [81359] (3 species)
  7. 2484760Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 2484776Domain d1gtuc2: 1gtu C:1-84 [32903]
    Other proteins in same PDB: d1gtua1, d1gtub1, d1gtuc1, d1gtud1

Details for d1gtuc2

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1gtuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtuc2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d1gtuc2:

Click to download the PDB-style file with coordinates for d1gtuc2.
(The format of our PDB-style files is described here.)

Timeline for d1gtuc2: