Lineage for d5kg9b1 (5kg9 B:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760112Domain d5kg9b1: 5kg9 B:1-108 [329028]
    Other proteins in same PDB: d5kg9a_, d5kg9h_
    automated match to d4k3el1

Details for d5kg9b1

PDB Entry: 5kg9 (more details), 2.3 Å

PDB Description: crystal structure of the gp120 v2 antibody re505-22 fab from igh- and igk-humanized mouse
PDB Compounds: (B:) Antibody RE505-22 Fab light chain

SCOPe Domain Sequences for d5kg9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kg9b1 b.1.1.0 (B:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkfvmelrkdgshntgd
gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlg

SCOPe Domain Coordinates for d5kg9b1:

Click to download the PDB-style file with coordinates for d5kg9b1.
(The format of our PDB-style files is described here.)

Timeline for d5kg9b1: