SCOP 1.75: Domain d1gtub2: 1gtu B:1-84

Lineage for d1gtub2 (1gtu B:1-84)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (23 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class mu GST [81359] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
Uniprot P09488
Uniprot P28161
Uniprot P09488 ! Uniprot P28161
Domain d1gtub2: 1gtu B:1-84 [32902]
Other proteins in same PDB: d1gtua1, d1gtub1, d1gtuc1, d1gtud1

Details for d1gtub2

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1gtub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtub2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

SCOP Domain Coordinates for d1gtub2:

Click to download the PDB-style file with coordinates for d1gtub2.
(The format of our PDB-style files is described here.)

Timeline for d1gtub2: