Lineage for d5huoa2 (5huo A:117-288)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839839Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2839840Protein automated matches [226879] (8 species)
    not a true protein
  7. 2839856Species Streptococcus pyogenes [TaxId:1115816] [328858] (1 PDB entry)
  8. 2839857Domain d5huoa2: 5huo A:117-288 [329019]
    Other proteins in same PDB: d5huoa1, d5huob1, d5huoc1, d5huoe1, d5huof1, d5huoh1
    automated match to d1x1oa2
    complexed with so4; mutant

Details for d5huoa2

PDB Entry: 5huo (more details), 2.8 Å

PDB Description: crystal structure of nadc deletion mutant in c2221 space group
PDB Compounds: (A:) Nicotinate-nucleotide diphosphorylase (Carboxylating)

SCOPe Domain Sequences for d5huoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huoa2 c.1.17.0 (A:117-288) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi
aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl
iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld

SCOPe Domain Coordinates for d5huoa2:

Click to download the PDB-style file with coordinates for d5huoa2.
(The format of our PDB-style files is described here.)

Timeline for d5huoa2: