Lineage for d5ll1g1 (5ll1 G:8-142)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizesSuperfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) 
bind purine or pterin in topologically similar sites between subunits
Family d.96.1.0: automated matches [227243] (1 protein)
not a true familyProtein automated matches [227009] (15 species)
not a true protein
Species Zebrafish (Danio rerio) [TaxId:7955] [327451] (2 PDB entries) 
Domain d5ll1g1: 5ll1 G:8-142 [329007]
automated match to d4n9sa1
Details for d5ll1g1
PDB Entry: 5ll1 (more details), 2.8 Å
PDB Description: crystal structure of urate oxidase from zebrafish
PDB Compounds: (G:) UricaseSCOPe Domain Sequences for d5ll1g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ll1g1 d.96.1.0 (G:8-142) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
nvefvrtgygknmvkvlhirregnhhhiielianvqltlktrkdyltgdnsdiiptdtvk
ntvhalaklkgiksiesfaldicehfltafnhvtrvkvnidevpwkrlekngvehnhafi
hcpealrfceaeqyl
SCOPe Domain Coordinates for d5ll1g1:
Click to download the PDB-style file with coordinates for d5ll1g1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ll1g1:
View in 3D
