Lineage for d5ll1g1 (5ll1 G:8-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2573513Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2573514Protein automated matches [227009] (15 species)
    not a true protein
  7. 2573652Species Zebrafish (Danio rerio) [TaxId:7955] [327451] (2 PDB entries)
  8. 2573665Domain d5ll1g1: 5ll1 G:8-142 [329007]
    automated match to d4n9sa1

Details for d5ll1g1

PDB Entry: 5ll1 (more details), 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish
PDB Compounds: (G:) Uricase

SCOPe Domain Sequences for d5ll1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ll1g1 d.96.1.0 (G:8-142) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
nvefvrtgygknmvkvlhirregnhhhiielianvqltlktrkdyltgdnsdiiptdtvk
ntvhalaklkgiksiesfaldicehfltafnhvtrvkvnidevpwkrlekngvehnhafi
hcpealrfceaeqyl

SCOPe Domain Coordinates for d5ll1g1:

Click to download the PDB-style file with coordinates for d5ll1g1.
(The format of our PDB-style files is described here.)

Timeline for d5ll1g1: