Lineage for d5j6aa1 (5j6a A:11-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708720Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 2708739Protein automated matches [230549] (2 species)
    not a true protein
  7. 2708740Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries)
  8. 2708751Domain d5j6aa1: 5j6a A:11-177 [329006]
    Other proteins in same PDB: d5j6aa2
    automated match to d1y8pa1
    complexed with p46

Details for d5j6aa1

PDB Entry: 5j6a (more details), 2.05 Å

PDB Description: crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor ps46
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5j6aa1:

Sequence, based on SEQRES records: (download)

>d5j6aa1 a.29.5.1 (A:11-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinl
lpdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptm
aqgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d5j6aa1 a.29.5.1 (A:11-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslagapkyiehfskfspsplsmkqfldfgscektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d5j6aa1:

Click to download the PDB-style file with coordinates for d5j6aa1.
(The format of our PDB-style files is described here.)

Timeline for d5j6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j6aa2