SCOP 1.75: Domain d2gtub2: 2gtu B:1-84

Lineage for d2gtub2 (2gtu B:1-84)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
   Uniprot P09488
   Uniprot P28161
   Uniprot P09488 ! Uniprot P28161

8. Domain d2gtub2: 2gtu B:1-84 [32900]
   Other proteins in same PDB: d2gtua1, d2gtub1

Details for d2gtub2

PDB Entry: 2gtu, 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d2gtub2:

Sequence; same for both SEQRES and ATOM records:

>d2gtub2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d2gtub2:

• d2gtub2 first appeared (with stable ids) in SCOP 1.55
  
• d2gtub2 appears in SCOP 1.73
  
• d2gtub2 appears in SCOPe 2.01
  
• d2gtub2 appears in the current release, SCOPe 2.08