| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries) |
| Domain d2gtub2: 2gtu B:1-84 [32900] Other proteins in same PDB: d2gtua1, d2gtub1 |
PDB Entry: 2gtu (more details), 2.55 Å
SCOP Domain Sequences for d2gtub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtub2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn
Timeline for d2gtub2: