Lineage for d2gtub2 (2gtu B:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876812Protein Class mu GST [81359] (3 species)
  7. 2876820Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 2876831Domain d2gtub2: 2gtu B:1-84 [32900]
    Other proteins in same PDB: d2gtua1, d2gtub1

Details for d2gtub2

PDB Entry: 2gtu (more details), 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2gtub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtub2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d2gtub2:

Click to download the PDB-style file with coordinates for d2gtub2.
(The format of our PDB-style files is described here.)

Timeline for d2gtub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtub1