SCOP 1.55: Domain d2gtua2: 2gtu A:1-84

Lineage for d2gtua2 (2gtu A:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries)

8. Domain d2gtua2: 2gtu A:1-84 [32899]
   Other proteins in same PDB: d2gtua1, d2gtub1

Details for d2gtua2

PDB Entry: 2gtu, 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d2gtua2:

Sequence; same for both SEQRES and ATOM records:

>d2gtua2 c.47.1.5 (A:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d2gtua2:

• d2gtua2 appears in SCOP 1.57
  
• d2gtua2 appears in the current release, SCOPe 2.08