![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries) |
![]() | Domain d5momb2: 5mom B:127-256 [328987] automated match to d1plqa2 mutant |
PDB Entry: 5mom (more details), 2.27 Å
SCOPe Domain Sequences for d5momb2:
Sequence, based on SEQRES records: (download)
>d5momb2 d.131.1.0 (B:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmgh lkyylapkie
>d5momb2 d.131.1.0 (B:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]} gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte avtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmghlkyylap kie
Timeline for d5momb2:
![]() Domains from other chains: (mouse over for more information) d5moma1, d5moma2, d5momc1, d5momc2 |