Lineage for d1hnaa2 (1hna A:1-84)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992478Protein Class mu GST [81359] (3 species)
  7. 992486Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 992497Domain d1hnaa2: 1hna A:1-84 [32898]
    Other proteins in same PDB: d1hnaa1
    complexed with gdn

Details for d1hnaa2

PDB Entry: 1hna (more details), 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1hnaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnaa2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d1hnaa2:

Click to download the PDB-style file with coordinates for d1hnaa2.
(The format of our PDB-style files is described here.)

Timeline for d1hnaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnaa1