Lineage for d1hna_2 (1hna 1-84)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584855Protein Class mu GST [81359] (3 species)
  7. 584863Species Human (Homo sapiens) [TaxId:9606] [52867] (10 PDB entries)
  8. 584870Domain d1hna_2: 1hna 1-84 [32898]
    Other proteins in same PDB: d1hna_1
    complexed with gdn; mutant

Details for d1hna_2

PDB Entry: 1hna (more details), 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hna_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hna_2 c.47.1.5 (1-84) Class mu GST {Human (Homo sapiens)}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1hna_2:

Click to download the PDB-style file with coordinates for d1hna_2.
(The format of our PDB-style files is described here.)

Timeline for d1hna_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hna_1