Lineage for d1hna_2 (1hna 1-84)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) Protein Glutathione S-transferase [52863] (22 species) 
Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) 
Domain d1hna_2: 1hna 1-84 [32898]
Other proteins in same PDB: d1hna_1
Details for d1hna_2
PDB Entry: 1hna (more details), 1.85 Å
PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
SCOP Domain Sequences for d1hna_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hna_2 c.47.1.5 (1-84) Glutathione S-transferase {Human (Homo sapiens), class mu}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn
SCOP Domain Coordinates for d1hna_2:
Click to download the PDB-style file with coordinates for d1hna_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hna_2:
- d1hna_2 appears in SCOP 1.57
- d1hna_2 appears in the current release, SCOPe 2.08, called d1hnaa2
View in 3D
