| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
| Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
| Protein automated matches [226879] (8 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:1115816] [328858] (1 PDB entry) |
| Domain d5huoe2: 5huo E:117-288 [328976] Other proteins in same PDB: d5huoa1, d5huob1, d5huoc1, d5huoe1, d5huof1, d5huoh1 automated match to d1x1oa2 complexed with so4; mutant |
PDB Entry: 5huo (more details), 2.8 Å
SCOPe Domain Sequences for d5huoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huoe2 c.1.17.0 (E:117-288) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi
aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl
iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld
Timeline for d5huoe2: