SCOPe 2.08: Domain d5ltcb_: 5ltc B:

Lineage for d5ltcb_ (5ltc B:)

1. Root: SCOPe 2.08
2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology
5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family
6. Protein automated matches [190039] (160 species)
   not a true protein
7. Species Vibrio cholerae [TaxId:666] [328970] (4 PDB entries)
8. Domain d5ltcb_: 5ltc B: [328972]
   automated match to d4pdha_

Details for d5ltcb_

PDB Entry: 5ltc, 2.1 Å

PDB Description: crystal structure of doubly spin labelled vcsiap r125

PDB Compounds: (B:) C4-dicarboxylate-binding periplasmic protein

SCOPe Domain Sequences for d5ltcb_:

Sequence; same for both SEQRES and ATOM records:

>d5ltcb_ c.94.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqcltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtaettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevycalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam

SCOPe Domain Coordinates for d5ltcb_ are not available.

Timeline for d5ltcb_:

• d5ltcb_ first appeared in SCOPe 2.06
  
• d5ltcb_ appears in SCOPe 2.07