Lineage for d5ltcb_ (5ltc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916398Species Vibrio cholerae [TaxId:666] [328970] (4 PDB entries)
  8. 2916404Domain d5ltcb_: 5ltc B: [328972]
    automated match to d4pdha_

Details for d5ltcb_

PDB Entry: 5ltc (more details), 2.1 Å

PDB Description: crystal structure of doubly spin labelled vcsiap r125
PDB Compounds: (B:) C4-dicarboxylate-binding periplasmic protein

SCOPe Domain Sequences for d5ltcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltcb_ c.94.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqcltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtaettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevycalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam

SCOPe Domain Coordinates for d5ltcb_:

Click to download the PDB-style file with coordinates for d5ltcb_.
(The format of our PDB-style files is described here.)

Timeline for d5ltcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ltca_