![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein automated matches [190263] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries) |
![]() | Domain d5fucb_: 5fuc B: [328968] Other proteins in same PDB: d5fuca2, d5fucc1, d5fucc2, d5fucd1, d5fucd2, d5fuce_, d5fucv_ automated match to d4cnic_ complexed with nag |
PDB Entry: 5fuc (more details), 2.7 Å
SCOPe Domain Sequences for d5fucb_:
Sequence, based on SEQRES records: (download)
>d5fucb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpd pttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
>d5fucb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkakittpdpttn aslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
Timeline for d5fucb_: