SCOPe 2.06: Domain d1gtid2: 1gti D:1-78

Lineage for d1gtid2 (1gti D:1-78)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein Class pi GST [81358] (4 species)
Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
Domain d1gtid2: 1gti D:1-78 [32895]
Other proteins in same PDB: d1gtia1, d1gtib1, d1gtic1, d1gtid1, d1gtie1, d1gtif1
complexed with gtb

Details for d1gtid2

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione

PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1gtid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtid2 c.47.1.5 (D:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d1gtid2:

Click to download the PDB-style file with coordinates for d1gtid2.
(The format of our PDB-style files is described here.)

Timeline for d1gtid2: