Lineage for d5g08a_ (5g08 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324368Protein automated matches [190064] (22 species)
    not a true protein
  7. 2324406Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (6 PDB entries)
  8. 2324407Domain d5g08a_: 5g08 A: [328942]
    automated match to d2lcpa_
    complexed with ca, edo, gol, z80

Details for d5g08a_

PDB Entry: 5g08 (more details), 1.52 Å

PDB Description: crystal structure of drosophila ncs-1 bound to chlorpromazine
PDB Compounds: (A:) frequenin 2

SCOPe Domain Sequences for d5g08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g08a_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
knsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpsk
faslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyn
ivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqals

SCOPe Domain Coordinates for d5g08a_:

Click to download the PDB-style file with coordinates for d5g08a_.
(The format of our PDB-style files is described here.)

Timeline for d5g08a_: