Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
Protein automated matches [226879] (8 species) not a true protein |
Species Streptococcus pyogenes [TaxId:1115816] [328858] (1 PDB entry) |
Domain d5huof2: 5huo F:117-288 [328940] Other proteins in same PDB: d5huoa1, d5huob1, d5huoc1, d5huoe1, d5huof1, d5huoh1 automated match to d1x1oa2 complexed with so4; mutant |
PDB Entry: 5huo (more details), 2.8 Å
SCOPe Domain Sequences for d5huof2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huof2 c.1.17.0 (F:117-288) automated matches {Streptococcus pyogenes [TaxId: 1115816]} iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld
Timeline for d5huof2: