SCOPe 2.08: Domain d5huof1: 5huo F:5-116

Lineage for d5huof1 (5huo F:5-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (11 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1115816] [328856] (1 PDB entry)

8. Domain d5huof1: 5huo F:5-116 [328939]
   Other proteins in same PDB: d5huoa2, d5huob2, d5huoc2, d5huoe2, d5huof2, d5huoh2
   automated match to d1x1oa1
   complexed with so4; mutant

Details for d5huof1

PDB Entry: 5huo, 2.8 Å

PDB Description: crystal structure of nadc deletion mutant in c2221 space group

PDB Compounds: (F:) Nicotinate-nucleotide diphosphorylase (Carboxylating)

SCOPe Domain Sequences for d5huof1:

Sequence; same for both SEQRES and ATOM records:

>d5huof1 d.41.2.0 (F:5-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
stdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvf
tlfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

Timeline for d5huof1:

• d5huof1 first appeared in SCOPe 2.06
  
• d5huof1 appears in SCOPe 2.07