Lineage for d5fucc2 (5fuc C:196-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762195Domain d5fucc2: 5fuc C:196-297 [328936]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fuce_, d5fucv_
    automated match to d1n26a3
    complexed with nag

Details for d5fucc2

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (C:) interleukin-6 receptor subunit alpha, interleukin-6 receptor

SCOPe Domain Sequences for d5fucc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fucc2 b.1.2.1 (C:196-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhavihdawsglrhvvqlraqeefgqgewsewspeamgtpwt

SCOPe Domain Coordinates for d5fucc2:

Click to download the PDB-style file with coordinates for d5fucc2.
(The format of our PDB-style files is described here.)

Timeline for d5fucc2: