![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1] [328882] (1 PDB entry) |
![]() | Domain d5hqlc1: 5hql C:1-138 [328933] Other proteins in same PDB: d5hqla2, d5hqlb2, d5hqlc2, d5hqld2, d5hqle2, d5hqlf2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5hql (more details), 2.53 Å
SCOPe Domain Sequences for d5hqlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hqlc1 d.58.9.0 (C:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hqlc1: