SCOPe 2.08: Domain d5itca_: 5itc A:

Lineage for d5itca_ (5itc A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Haloquadratum walsbyi [TaxId:362976] [275383] (5 PDB entries)

8. Domain d5itca_: 5itc A: [328932]
   automated match to d1cwqa_
   complexed with olb, olc, ret

Details for d5itca_

PDB Entry: 5itc, 2 Å

PDB Description: 2.2-angstrom in meso crystal structure of haloquadratum walsbyi bacteriorhodopsin (hwbr) from styrene maleic acid (sma) polymer nanodiscs

PDB Compounds: (A:) Bacteriorhodopsin-I

SCOPe Domain Sequences for d5itca_:

Sequence; same for both SEQRES and ATOM records:

>d5itca_ f.13.1.0 (A:) automated matches {Haloquadratum walsbyi [TaxId: 362976]}
lgvegegiwlalgtigmllgmlyfiadgldvqdprqkefyvitilipaiaaasylsmffg
fgltevslangrvvdvywaryadwlfttplllldigllagasqrdigalvgidafmivtg
lvatltkvvvaryafwtistismvfllyylvavfgeavsdadedtrstfnalrniilvtw
aiypvawlvgteglaltglygetllfmvldlvakvgfgfillrsraim

Timeline for d5itca_:

• d5itca_ first appeared in SCOPe 2.06
  
• d5itca_ appears in SCOPe 2.07