SCOPe 2.06: Domain d5j71a1: 5j71 A:12-176

Lineage for d5j71a1 (5j71 A:12-176)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries)

8. Domain d5j71a1: 5j71 A:12-176 [328923]
   Other proteins in same PDB: d5j71a2
   automated match to d1y8pa1
   complexed with p35, tla

Details for d5j71a1

PDB Entry: 5j71, 1.65 Å

PDB Description: crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor ps35

PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5j71a1:

Sequence, based on SEQRES records:

>d5j71a1 a.29.5.1 (A:12-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlif

Sequence, based on observed residues (ATOM records):

>d5j71a1 a.29.5.1 (A:12-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldcektsftflrqelpvrlanimkeinllpdrvls
tpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgvley
kdtygddpvsnqniqyfldrfylsrisirmlinqhtlif

Timeline for d5j71a1:

• d5j71a1 is new in SCOPe 2.06-stable
  
• d5j71a1 appears in SCOPe 2.07
  
• d5j71a1 appears in the current release, SCOPe 2.08