Lineage for d5jiwa_ (5jiw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830547Species Thermus aquaticus [TaxId:271] [328921] (1 PDB entry)
  8. 2830548Domain d5jiwa_: 5jiw A: [328922]
    automated match to d1fp8a_
    complexed with co3, edo

Details for d5jiwa_

PDB Entry: 5jiw (more details), 1.73 Å

PDB Description: crystal structure of thermus aquaticus amylomaltase (gh77) in complex with a 34-meric cycloamylose
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d5jiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jiwa_ c.1.8.1 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvriahfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafdxgmenpflphnypahgrvvvytgthnndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

SCOPe Domain Coordinates for d5jiwa_:

Click to download the PDB-style file with coordinates for d5jiwa_.
(The format of our PDB-style files is described here.)

Timeline for d5jiwa_: