![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein automated matches [190099] (31 species) not a true protein |
![]() | Species Thermus aquaticus [TaxId:271] [328921] (1 PDB entry) |
![]() | Domain d5jiwa_: 5jiw A: [328922] automated match to d1fp8a_ complexed with co3, edo |
PDB Entry: 5jiw (more details), 1.73 Å
SCOPe Domain Sequences for d5jiwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jiwa_ c.1.8.1 (A:) automated matches {Thermus aquaticus [TaxId: 271]} melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvriahfrgfea yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg mkvlqfafdxgmenpflphnypahgrvvvytgthnndttlgwyrtatphekafmarylad wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg elspehgarlramaeaterl
Timeline for d5jiwa_: