SCOPe 2.06: Domain d5hqma1: 5hqm A:3-138

Lineage for d5hqma1 (5hqm A:3-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:1085] [328912] (1 PDB entry)

8. Domain d5hqma1: 5hqm A:3-138 [328913]
   Other proteins in same PDB: d5hqma2, d5hqmb2
   automated match to d4lf2a1
   complexed with cap, k, mg

Details for d5hqma1

PDB Entry: 5hqm, 1.95 Å

PDB Description: structure function studies of r. palustris rubisco (r. palustris/r. rubrum chimera)

PDB Compounds: (A:) Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqma1:

Sequence; same for both SEQRES and ATOM records:

>d5hqma1 d.58.9.0 (A:3-138) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
qsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevsttd
dftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdveya
kmydfyvppaylklfd

Timeline for d5hqma1:

• d5hqma1 is new in SCOPe 2.06-stable
  
• d5hqma1 appears in SCOPe 2.07
  
• d5hqma1 appears in the current release, SCOPe 2.08