Lineage for d5hqma1 (5hqm A:3-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953253Species Rhodospirillum rubrum [TaxId:1085] [328912] (1 PDB entry)
  8. 2953254Domain d5hqma1: 5hqm A:3-138 [328913]
    Other proteins in same PDB: d5hqma2, d5hqmb2
    automated match to d4lf2a1
    complexed with cap, k, mg

Details for d5hqma1

PDB Entry: 5hqm (more details), 1.95 Å

PDB Description: structure function studies of r. palustris rubisco (r. palustris/r. rubrum chimera)
PDB Compounds: (A:) Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqma1 d.58.9.0 (A:3-138) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
qsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevsttd
dftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdveya
kmydfyvppaylklfd

SCOPe Domain Coordinates for d5hqma1:

Click to download the PDB-style file with coordinates for d5hqma1.
(The format of our PDB-style files is described here.)

Timeline for d5hqma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hqma2